PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA11G15310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 305aa    MW: 32857.6 Da    PI: 7.1559
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA11G15310.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601352.8e-4271061100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++e+reda++sl+yeAear+rdPvyG+v+ i+ lq +++q++ ++
  ONIVA11G15310.1   7 PCAACKLLRRKCTQGCVFAPYFPPDQPAKFANVHKVFGASNVTKLLNDLQPEQREDAVNSLAYEAEARLRDPVYGCVAYISILQLRIKQVRDQI 100
                      7********************************************************************************************9 PP

           DUF260  95 allkee 100
                      + +++e
  ONIVA11G15310.1 101 VDARKE 106
                      998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381557.9E-1154305IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.7386107IPR004883Lateral organ boundaries, LOB
PfamPF031959.2E-427103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MSSSSSPCAA CKLLRRKCTQ GCVFAPYFPP DQPAKFANVH KVFGASNVTK LLNDLQPEQR  60
EDAVNSLAYE AEARLRDPVY GCVAYISILQ LRIKQVRDQI VDARKELAAY IGPTAFAPVV  120
AAAAPHTHYL PPADYHHQQL QAQGGGGGAG MGAAGYAHQV VQHQMAGLQV QHPHPHPHHH  180
HHHQQMVNAQ HMALVEVARD QDMLRARQAG HANAGATVAV EAPGSSSLNA DTFDGGPFLL  240
RQQPPSSVQT EPAMALPYHM EPSPPQPSSG HSHDEVSQQQ QHHHHHRHHH TDGSDEGSGG  300
AAPPG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629364.11e-170PREDICTED: LOB domain-containing protein 36
TrEMBLA0A0E0J2P00.0A0A0E0J2P0_ORYNI; Uncharacterized protein
TrEMBLA2XJI00.0A2XJI0_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA013119-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.17e-60ASYMMETRIC LEAVES 2-like 1